PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR02G04250.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family M-type_MADS
Protein Properties Length: 224aa    MW: 24163.2 Da    PI: 4.7927
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR02G04250.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF34.92e-11249150
                     S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
           SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                     k ie+k  rqv  +  r g+ KKA+ELS LC+a  av+ fs+ g+ + ++
  LPERR02G04250.1  2 KAIEDKNARQV--CAGRDGVYKKASELSALCGAHFAVVFFSPAGNPHSFA 49
                     57999999999..6779***************************988876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF554551.18E-14175IPR002100Transcription factor, MADS-box
PROSITE profilePS5006613.848152IPR002100Transcription factor, MADS-box
SMARTSM004325.1E-6151IPR002100Transcription factor, MADS-box
PfamPF003199.4E-14448IPR002100Transcription factor, MADS-box
PRINTSPR004042.4E-51429IPR002100Transcription factor, MADS-box
PRINTSPR004042.4E-52950IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 224 aa     Download sequence    Send to blast
MKAIEDKNAR QVCAGRDGVY KKASELSALC GAHFAVVFFS PAGNPHSFAH PSLRSVSDRF  60
LSLSAAPETT TRQEEMVVRE FNQAEERLTE ARRRDALDEV DDGDDVRRAG VVELVSVAAA  120
LEGIRVEVAE RVREIVAAAA VAEETMLLHL QYGAAAAAME DDKLLIGGDF VHAPPSLHPH  180
FERDGFGYSG FAGGGYGYDF EVLDGWTMAM AAMAPATAST MKQK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A0D9VCJ31e-163A0A0D9VCJ3_9ORYZ; Uncharacterized protein
STRINGLOC_Os02g06860.12e-44(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP133092432
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G34440.17e-16AGAMOUS-like 29